PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02466.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 435aa    MW: 45758.2 Da    PI: 6.3221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02466.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-18111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+eEde l+  v+ +G + W++I+r++  gR +kqc++rw ++l
   Pahal.I02466.1 111 RGPWTEEEDETLKAMVEVYGERKWAAISRHLH-GRIGKQCRERWTNHL 157
                      89******************************.************996 PP

2Myb_DNA-binding51.13.2e-16165207145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+ +d  l++a+k +G++ W+ Iartm  gR+++++k++w+
   Pahal.I02466.1 165 KNTWTEKDDMDLIEAHKVHGNR-WSMIARTME-GRSENSVKNHWN 207
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.386106161IPR017930Myb domain
SMARTSM007175.5E-17110159IPR001005SANT/Myb domain
SuperFamilySSF466892.92E-29110206IPR009057Homeodomain-like
PfamPF002496.4E-16111157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-22111164IPR009057Homeodomain-like
CDDcd001671.01E-15113157No hitNo description
PROSITE profilePS5129416.845162214IPR017930Myb domain
SMARTSM007171.2E-12164212IPR001005SANT/Myb domain
PfamPF002491.3E-12165207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-14165211IPR009057Homeodomain-like
CDDcd001671.19E-10167210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MDGGSSVRFG HGVAAGPVHL GGGGGGAHQV MPAGAGMIPA GMGSFLLGAS GMLAPGGNMV  60
QPGGYLAPAG YSTVPNALHA AWNGVAAAGG GQQQPPASAG SGLLTRLPPL RGPWTEEEDE  120
TLKAMVEVYG ERKWAAISRH LHGRIGKQCR ERWTNHLRPE IDKAKNTWTE KDDMDLIEAH  180
KVHGNRWSMI ARTMEGRSEN SVKNHWNATK RSLKAKRRLK KKKNAEAPPG QQWSVLEEYI  240
RSLRPDDLAA APPAPPSDDS PPSSYNVGYD GEVVSPPAAP GGGFDPAALG LYLSAAGGNN  300
SSAVNLAAMN PNMAAPPYLG LDLNAYYYGA PLQQAPPQMM MMGQGQQATA DNLITYPFVD  360
HLAWHSPVPN ADAYAASNAN AAAGQHYYYY SDAGAAAAAS ANPEDDVDVV QMASREFQLN  420
PSEEEVTLNL AGFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-381102096103B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986358.11e-107PREDICTED: transcription factor MYB98-like
TrEMBLK4ALU71e-134K4ALU7_SETIT; Uncharacterized protein
STRINGSi039882m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.11e-34myb domain protein 64